PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g73380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 125aa    MW: 14506 Da    PI: 11.9067
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g73380genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA86.44.1e-272074358
   CBFB_NFYA  3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                p+YVNaKQy++IlkRRq  ak ++++kl +k+rkpylh+SRh+hA++R Rg gG F
  CA00g73380 20 PIYVNAKQYSAILKRRQVHAKRQDQNKL-IKNRKPYLHKSRHRHAMKRSRGFGGCF 74
                9***************************.*************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.1E-281677IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115230.7681777IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.2E-232074IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-202042IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-205174IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MVGVTTIRVA LPLECIEIFP IYVNAKQYSA ILKRRQVHAK RQDQNKLIKN RKPYLHKSRH  60
RHAMKRSRGF GGCFLNTKNM QQSKPSSPKH DRNIFNHQAG VLALAIRDSL TIHPWILRGD  120
RRTW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-182079463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15867RHRHAMKRSR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8654091e-122KJ865409.1 Capsicum annuum cultivar CMS line FS4401 mitochondrion, complete genome.
GenBankKJ8654101e-122KJ865410.1 Capsicum annuum cultivar Jeju mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqYP_009049690.18e-57hypothetical protein (mitochondrion)
SwissprotQ9LNP65e-28NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLA0A075VW319e-57A0A075VW31_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000559826e-54(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48002027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.43e-29nuclear factor Y, subunit A8